PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9KG312300.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 190aa    MW: 21698.2 Da    PI: 10.4811
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9KG312300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.16.4e-30959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krien + rqvtfskRrng+lKKA+ELSvLCdaev +i+fs++gklye+ss
  Pavir.9KG312300.2.p  9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVGLIVFSPRGKLYEFSS 59
                         79***********************************************96 PP

2K-box71.42.7e-2477173399
                K-box   3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 
                          + s+k++ +++ ++ + ++  L +++e L+ ++R++lGe+Le +s++eL++Le +Leksl  iR kK++ll +qi +l++ke+ l ++nk
  Pavir.9KG312300.2.p  77 NLSNKDTRQQDIQQVKADALSLANRLEALEMTKRKFLGENLEGCSVEELHSLEVKLEKSLHVIRGKKTQLLEQQIAKLKEKERTLLKDNK 166
                          578888999********************************************************************************* PP

                K-box  93 aLrkkle 99 
                          +Lr+k++
  Pavir.9KG312300.2.p 167 ELREKVA 173
                          *****97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.581161IPR002100Transcription factor, MADS-box
SMARTSM004321.7E-40160IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002651.10E-39379No hitNo description
PRINTSPR004049.0E-31323IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.15E-32384IPR002100Transcription factor, MADS-box
PfamPF003197.7E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004049.0E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004049.0E-313859IPR002100Transcription factor, MADS-box
PfamPF014862.9E-2584172IPR002487Transcription factor, K-box
PROSITE profilePS5129714.00688178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MVRGKTEMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVGLIVFSP RGKLYEFSSA  60
SSLQKTIDRY KSYTRENLSN KDTRQQDIQQ VKADALSLAN RLEALEMTKR KFLGENLEGC  120
SVEELHSLEV KLEKSLHVIR GKKTQLLEQQ IAKLKEKERT LLKDNKELRE KVAATKHLLV  180
SVKHLQSVN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A6e-17373271Myocyte-specific enhancer factor 2A
3mu6_B6e-17373271Myocyte-specific enhancer factor 2A
3mu6_C6e-17373271Myocyte-specific enhancer factor 2A
3mu6_D6e-17373271Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.112841e-177leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0648231e-170BT064823.1 Zea mays full-length cDNA clone ZM_BFb0180I10 mRNA, complete cds.
GenBankKJ7269281e-170KJ726928.1 Zea mays clone pUT3473 MADS transcription factor (MADS76) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983814.11e-111PREDICTED: MADS-box transcription factor 56-like
SwissprotA2Z9Q71e-92MAD56_ORYSI; MADS-box transcription factor 56
TrEMBLC0P9541e-104C0P954_MAIZE; MADS transcription factor
STRINGSb01g030570.11e-105(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.18e-71AGAMOUS-like 20